PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g033910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28588.2 Da    PI: 9.3112
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g033910.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.16.3e-30959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtfskRr g+lKKA+E+SvLCdaev +i+fs++gkl+eys+
  Sopen03g033910.1  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYST 59
                      79***********************************************96 PP

2K-box1027.9e-34801746100
             K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                        ++++  +  s++ e+akLk+++e Lqr+q+h+ Ge+L++Ls+keLq+Le+qL+++lk+iRs+Kn+l++e+i+elqkk k+lqe+n++L+k++
  Sopen03g033910.1  80 LNATDIVTPGSWTLEHAKLKARLEVLQRNQKHYAGEELDTLSMKELQNLEHQLDSALKHIRSRKNQLMHESISELQKKDKALQEQNNNLSKQV 172
                       555555666799********************************************************************************9 PP

             K-box  99 ee 100
                       +e
  Sopen03g033910.1 173 KE 174
                       86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.184161IPR002100Transcription factor, MADS-box
CDDcd002657.44E-42279No hitNo description
SuperFamilySSF554556.54E-34287IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-31323IPR002100Transcription factor, MADS-box
PfamPF003196.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129716.20288178IPR002487Transcription factor, K-box
PfamPF014866.9E-2890172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVGLIVFST KGKLFEYSTD  60
SCMERILERY ERYSYAERQL NATDIVTPGS WTLEHAKLKA RLEVLQRNQK HYAGEELDTL  120
SMKELQNLEH QLDSALKHIR SRKNQLMHES ISELQKKDKA LQEQNNNLSK QVKEREKEMA  180
QQTPWEQQSH DHLNSSSFGL PHPFNNLHIG EAYPNAGDNG EVEGSSRQQQ QNSTSVMPPW  240
MLRHLNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-22186185Myocyte-specific enhancer factor 2B
1tqe_Q1e-22186185Myocyte-specific enhancer factor 2B
1tqe_R1e-22186185Myocyte-specific enhancer factor 2B
1tqe_S1e-22186185Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0140570.0BT014057.1 Lycopersicon esculentum clone 133155F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015068141.10.0PREDICTED: agamous-like MADS-box protein AGL8 homolog
SwissprotQ424291e-143AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLK4BKY50.0K4BKY5_SOLLC; Uncharacterized protein
STRINGSolyc03g114830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-106AGAMOUS-like 8